PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_13717.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 119aa    MW: 13460.6 Da    PI: 4.5484
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_13717.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM27.87.3e-094475194
                      NAM 51 vkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94
                             +k+++  wyfFs r + y++ ++++ +t sgyWk tgk+ +  +
  Rsa1.0_13717.1_g00001.1  4 IKSRDLAWYFFSDRGSLYRNTNKQSLTTPSGYWKITGKTAQTSH 47
                             5677789*************999999************887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100510.4141119IPR003441NAC domain
SuperFamilySSF1019413.53E-9543IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
LSRIKSRDLA WYFFSDRGSL YRNTNKQSLT TPSGYWKITG KTAQTSHMVC KVEYTGPADS  60
LQIAGESTSE RTAESLQIAR ESTSERPAES LQIANEDGYS DSYWEGNVNT NEDWDTYLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2893923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.11e-09NAC domain containing protein 53